PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0064900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 169aa    MW: 18601.7 Da    PI: 6.7831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0064900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151760347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      W  +Ede l ++v  +G ++Wk+I++ ++ gRt+  c+srw++ 
   Spipo6G0064900 17 MWNSDEDEALRRLVDHFGDRNWKLISAAIP-GRTPRACRSRWLNC 60
                     5*****************************.***********996 PP

2Myb_DNA-binding49.78.3e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++Ede+++ a +++G++ W+tIar ++ gRt+  +  rw +
   Spipo6G0064900  67 RGPFTADEDEIIIAAQAKHGNR-WATIARLLP-GRTGPAVEYRWCT 110
                      89********************.*********.***********76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.1881065IPR017930Myb domain
SuperFamilySSF466892.27E-2813108IPR009057Homeodomain-like
SMARTSM007172.6E-111463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-221868IPR009057Homeodomain-like
CDDcd001672.61E-121859No hitNo description
PfamPF139211.0E-141875No hitNo description
PROSITE profilePS5129416.87566116IPR017930Myb domain
SMARTSM007176.0E-1366114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1969111IPR009057Homeodomain-like
CDDcd001672.05E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MGDAAEDEGG RSAVKRMWNS DEDEALRRLV DHFGDRNWKL ISAAIPGRTP RACRSRWLNC  60
LSPNVVRGPF TADEDEIIIA AQAKHGNRWA TIARLLPGRT GPAVEYRWCT MPARDRWTES  120
SDSAAREPTT SLPIGPHGDE EAPAASGGGG GDQRENEEMK AYLMSRRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23141146106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480196.15e-34PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-30MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2PYB56e-34A0A0D2PYB5_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.15e-27myb domain protein 1